Store Offer Menu

  • Image
    Daikin Thermostat,2-Stage 067186101 - All

    Daikin Thermostat,2-Stage 067186101 - All

    Product information for Daikin Thermostat,2-Stage 067186101 - All

    $220.99
    $203.058% OFF

    Line Volt Mechanical Thermostat, Number of Stages Dual, Product Type Heat/Cool Control

  • More Deals You’ll Love

    Unbeatable Sale logo

    NETH-Neon Tropics Skin for Nest Thermostat - Neon ...

    Skin for Nest Thermostat

    You're in the right place because we've got exactly what you're looking for! This Neon Tropics skin is the perfect way to show off your style! Or with hundreds of other MightySkins designs, you can be sure to find one that you'll love, and that will show off your unique style!

    With MightySkins your thermostat is protected from scratches, dings, dust, fingertips, and the wear-and-tear of everyday use! Cover your Nest Thermostat with a beautiful, stylish decal skin and keep it protected at the same time! Easy to apply, and easy to remove without any sticky residue! Make your favorite gear look like new, and stand out from the crowd!

    Features
    • Vinyl decal sticker
    • Not A Hard Case
    • Matte Finish
    • Ultra-Thin, Ultra-Durable, Stain Resistant
    • Hundreds of different designs
    • Nest Thermostat is not included
    • Protective, Durable, and Unique Vinyl Decal wrap cover
    • Easy To Apply, Remove and Change Styles
    • Made in the USA
    Specifications
    • Design: Neon Tropics
    • Weight: 0.01 lbs
    $16.76
    $8.8447% OFF
    Unbeatable Sale logo

    TX2888D Engine Coolant Thermostat for 1993-1993 BM...

    We provide a wide range of products to satisfy all houseware and supplies. We are dedicated to give everyone the very best houseware supplies for all home needs, with a focus on dependability, our client satisfaction and great quality. We provide high-quality modern products to be enjoyed by many clients. Our aim is continuous improvement and user satisfaction through effective implementation and quality of our products.

    Features
    • Engine Coolant Thermostat
    • Assured for high quality and standards
    Compatibility:
    • 1993-1993 BMW 525iT
    $32.53
    $25.0223% OFF
    OnBuy logo

    Tuya Smart Wireless Thermostat for Gas Boiler(B)

    Thisadvanceddeviceoffersunparalleledconvenienceandcontroloveryourboiler'stemperature,ensuringthatyourhomeisalwaysattheperfecttemperature.
    £57.62
    £44.9422% OFF
    sylvane logo

    Honeywell Home RTH2300B 5-2-Day Programmable Therm...

    The Honeywell Home 5-2 Day Programmable Thermostat lets you set your heating and cooling systems to run at up to 4 different temperatures on weekdays and weekends. Program it to adjust to different temperatures while you're away or asleep, you can significantly lower your energy bills without compromising your comfort. Features like a backlit display, intuitive controls, and programming flexibility make this Honeywell model a top choice.
    $28.99
    $24.9914% OFF
    Shop.com logo

    Robertshaw Electric Thermostat,120/277VAC,450F Max...

    Electric Thermostat, Product Type Electric Thermostat, Capillary Tube Length 36 in, Sensing Bulb Diameter 1/4 in, Stem Length 7/8 in, Sensing Bulb Length 10 in, Compatible with Brand Consolidated Communications, General Electric, Hobart, Johnstone, Robertshaw, Uni-Line, OEM Replacement Part Number 23796, 342027-1, 342027P1, 342067-1, 344635-00002, 344635-2, 5302-114, 54B107070P1, 600469, E-121, F16-598, S-12-36, S-121-36, S-29-36, S-384-36, XNC8X15, XNC8X67, Compatible with Series 5300 Series
    $150.99
    $137.869% OFF
    Isotonix logo

    Danfoss Thermostatic Radiator Valve,Straight 013G-...

    Thermostatic Radiator Valve, 1 In., Straight Body, For Use With Mfr. Model Number 088H-3110, Fits Brand Danfoss
    $158.99
    $145.249% OFF
    Shop.com logo

    Danfoss Thermostatic Radiator Valve,Straight 013G-...

    Thermostatic Radiator Valve, 1 In., Straight Body, For Use With Mfr. Model Number 088H-3110, Fits Brand Danfoss
    $158.99
    $145.249% OFF
    sylvane logo

    Honeywell Home Wi-Fi 7-Day Programmable Thermostat

    With this Wi-Fi 7 day programmable thermostat, you can program different settings every day and make adjustments from anywhere with internet access. Various alerts and 5-day local weather forecasts can also be seen on its digital screen.
    $99.99
    $94.995% OFF

    Subscribe to Motives Cosmetics coupon newsletter

    Get notified of offers and coupon codes from Motives Cosmetics before they expire!